PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00016301-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 228aa    MW: 26071.8 Da    PI: 7.0591
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00016301-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.94.6e-5662157297
                  NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 
                            +eqdrflPianv+rimk+v+Pan+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd+lwa++tlGfe+yv+plk+yl+k
  SMil_00016301-RA_Salv  62 KEQDRFLPIANVGRIMKRVMPANGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDILWAITTLGFEEYVHPLKKYLAK 149
                            89************************************************************************************** PP

                  NF-YB  90 yrelegek 97 
                            yre+egek
  SMil_00016301-RA_Salv 150 YREIEGEK 157
                            *****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.7E-5355174IPR009072Histone-fold
SuperFamilySSF471131.18E-3964164IPR009072Histone-fold
PfamPF008081.8E-2767131IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.9E-2095113No hitNo description
PROSITE patternPS00685098114IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.9E-20114132No hitNo description
PRINTSPR006155.9E-20133151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MKRDRDDFED DEKPQIGPSR TPYRISPDTT TSSYPNTTTN QNPYASKNTT NNNNNNNNSN  60
NKEQDRFLPI ANVGRIMKRV MPANGKISKD AKETVQECVS EFISFVTGEA SDKCQREKRK  120
TINGDDILWA ITTLGFEEYV HPLKKYLAKY REIEGEKLNV PKQQRVEQRM QHDQNSSNHL  180
PYNSVYSAAN LISPPPFVSA DPPFPLPFSQ NSIQTAALPQ HDRVDDHW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4462152292Transcription factor HapC (Eurofung)
4g92_B1e-4462152292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099714.11e-104PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT96e-66NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLG7LE458e-85G7LE45_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA05G32680.14e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.13e-62nuclear factor Y, subunit B7